Avexitide (Exendin(9-39) amide) is the fastest-developing GLP-1 receptor antagonist worldwide; it is a linear polypeptide composed of 31 amino acids with a C-terminal amide modification.

Avexitide (Exendin-(9–39) amide) is a linear polypeptide consisting of 31 amino acids, with a C-terminal amide group and no disulfide bonds; its molecular formula is C₁₄₉H₂₃₄N₄₀O₄₇S, and its molecular weight is 3369.76.

Nuclear Structure

Number of amino acids: 31 aa (derived from the 9–39 fragment of Exendin-4)

Single-letter sequence: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂

Three-letter sequence:Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂

Molecular Formula‌：C149H234N48O47S

Molecular Weight‌：3369.76 Da

‌CAS‌：133514-43-9

Modifying feature‌：Free N-terminus, C-terminal serine amidation (-NH₂); no glycosylation, phosphorylation or disulfide bonds; linear straight-chain structure

Contact Us

We can supply various peptide fragments required for the synthesis of Avexitide.Our relevant fragments are well‑controlled on impurity profiles and meet high-quality synthesis standards. We are capable of supporting small-scale trial orders as well as bulk commercial‑grade supplies.

Phone: +86-18986204913

Tel: +86-027-83338163

E-Mail: info@cosperpharma.com